Ipamorelin is a synthetic pentapeptide GH secretagogue supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Ipamorelin: A Selective GHS-R1a Agonist With Distinct Immune BiologyIpamorelin (Aib-His-D-2-Nal-D-Phe-Lys-NH₂;…
William
Sermorelin (GHRH 1–29 NH₂) is a synthetic 29-amino acid growth hormone-releasing hormone analogue supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Sermorelin and the Brain: GHRH…
LL-37 is a synthetic cathelicidin antimicrobial peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.LL-37 in the Central Nervous System: Beyond Antimicrobial BiologyLL-37 ([LL-37, 37 aa];…
BPC-157 (Body Protection Compound 157) is a synthetic 15-amino acid peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.BPC-157: Immunomodulatory Biology of a Gastric Cytoprotective…
GHRP-6 and Hexarelin are synthetic GH secretagogue peptides supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Introduction: Two GHS-R1a Agonists, Distinct Immune ProfilesGHRP-6 (His-D-Trp-Ala-Trp-D-Phe-Lys-NH₂; MW…
Retatrutide (LY3437943) is a synthetic triple receptor agonist targeting GIP, GLP-1 and glucagon receptors, supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Retatrutide: Triple Incretin Biology…
Melanotan 2 (MT-II) is a synthetic melanocortin receptor agonist supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Melanotan 2: Melanocortin Receptors in the Central Nervous System…
Follistatin (FST) is a synthetic peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Follistatin: Activin Antagonism at the Immune InterfaceFollistatin (FST; MW ~35 kDa…
Oxytocin is a synthetic neuropeptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Oxytocin in Male Reproductive Biology: Beyond Uterine ContractionOxytocin (OT; MW 1,007 Da;…
Thymosin Alpha-1 (Tα1) is a synthetic 28-amino acid thymic peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Thymosin Alpha-1 and the Neuroimmune InterfaceThymosin Alpha-1…
Sermorelin (GHRH 1–29 NH₂) is a synthetic 29-amino acid analogue of endogenous growth hormone-releasing hormone supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Sermorelin: Structural Biology…
AOD-9604 (Advanced Obesity Drug fragment 176–191) is a synthetic peptide fragment of human growth hormone supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.AOD-9604: Structural Identity…
