Selank and Immune Function Research: Th1/Th2 Immunomodulation, Cytokine Biology and Autoimmune Mechanisms UK 2026Research Use Only. Selank is not licensed as an immunomodulatory agent in the UK outside of approved clinical contexts. All content describes preclinical and investigational research biology. Not medical advice.Selank (Thr-Lys-Pro-Arg-Pro-Gly-Pro, a heptapeptide analogue of the immunomodulatory peptide Tuftsin Thr-Lys-Pro-Arg)…
William
Epitalon and Skin Ageing Research: Telomere Biology, Fibroblast Senescence and Photoageing Mechanisms UK 2026Research Use Only. Epitalon is not licensed as a dermatological or anti-ageing therapeutic in the UK. All content describes preclinical and investigational research biology. Not medical advice.Skin ageing is driven by two overlapping processes: intrinsic (chronological) ageing, involving telomere shortening,…
MGF and Cardiac Biology Research: Mechano Growth Factor, Cardiomyocyte Survival and Heart Repair Mechanisms UK 2026Research Use Only. MGF (Mechano Growth Factor) and PEG-MGF are not licensed cardiac therapeutics in the UK. All content describes preclinical and investigational research biology. Not medical advice.Mechano Growth Factor (MGF, also known as IGF-1Ec) is a splice…
LL-37 and Skin Research: Dermal Innate Immunity, Wound Repair Biology and Keratinocyte Mechanisms UK 2026Research Use Only. LL-37 is not licensed as a dermatological therapeutic in the UK. All content describes preclinical and investigational research biology. Not medical advice.LL-37 (the C-terminal 37-amino acid peptide of human cathelicidin hCAP-18, sequence [LL-37, 37 aa]) is the only…
GHRP-6 and Bone Research: GH Axis, Osteoblast Biology and Skeletal Mechanisms UK 2026Research Use Only. GHRP-6 is not licensed for osteoporosis or bone disease treatment in the UK. All content describes preclinical and investigational research biology. Not medical advice.Bone biology is intimately regulated by the growth hormone-IGF-1 axis, making GH secretagogues including GHRP-6…
Semax and Autism Research: Neuropeptide Biology, Social Cognition and ASD Mechanisms UK 2026Research Use Only. Semax is not licensed for autism spectrum disorder in the UK. All content describes preclinical and investigational research biology. Not medical advice.Autism spectrum disorder (ASD) is a neurodevelopmental condition characterised by impairments in social communication and interaction alongside…
Best Peptides for Fertility Research UK 2026: HPG Axis Biology, Reproductive Mechanisms and Gonadal ScienceResearch Use Only. All compounds described are investigational peptides not licensed for fertility treatment in the UK. This content is for researchers and laboratory professionals. Not medical advice.Fertility research encompasses the neuroendocrine regulation of reproductive function, gonadal biology, gametogenesis,…
GHK-Cu vs Collagen Peptides: Comparing Skin Regeneration Biology, Collagen Synthesis Mechanisms and Research Applications UK 2026Research Use Only. GHK-Cu is an investigational peptide not licensed as a therapeutic in the UK. Collagen peptides (hydrolysates) are food supplement-grade ingredients. All mechanistic content describes preclinical and investigational research biology. Not medical advice.Both GHK-Cu (copper tripeptide)…
Best Peptides for Energy and Mitochondrial Research UK 2026: Metabolic Biology, ATP Production and Cellular Energy MechanismsResearch Use Only. All compounds described below are investigational peptides not licensed for human use in the UK outside of approved clinical contexts. This content is intended for researchers and laboratory professionals. Not medical advice.Mitochondrial biology sits…
Kisspeptin-10 and Cancer Biology: Tumour Suppression, Metastasis Inhibition and Oncological Research UK 2026Research Use Only. Kisspeptin-10 is not licensed as an oncological therapeutic in the UK. All content describes preclinical and investigational research. Not medical advice.Kisspeptin-10 (KP-10, the C-terminal decapeptide of kisspeptin-54) was originally identified not as a reproductive neuropeptide but as a…
DSIP and Pain Research: Nociception Biology, Opioid Interaction and Circadian Pain Mechanisms UK 2026Research Use Only. DSIP (Delta Sleep-Inducing Peptide) is not licensed for human use in the UK. All content describes preclinical and investigational research biology. Not medical advice.Delta Sleep-Inducing Peptide (DSIP, Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu) is a nonapeptide with well-characterised effects on sleep architecture…
Thymosin Alpha-1 and Kidney Research: Renal Immunology, Nephroprotection and Tubular Biology UK 2026
Thymosin Alpha-1 and Kidney Research: Renal Immunology, Nephroprotection and Tubular Biology UK 2026Research Use Only. Thymosin Alpha-1 (Tα1) is not licensed in the UK for the indications described below. All content describes preclinical and investigational research biology. Not medical advice.Thymosin Alpha-1 (Tα1, thymalfasin, Zadaxin®) is a 28-amino acid peptide derived from prothymosin-α, with…
