This article is intended for researchers and laboratory scientists. BPC-157 is a research peptide supplied for laboratory and in vitro use only. All findings described are from preclinical models or early-phase studies. This content does not constitute medical advice.Introduction: BPC-157 and Renal BiologyBody Protection Compound-157 (BPC-157) is a synthetic pentadecapeptide derived from human…
William
This article is intended for researchers and laboratory scientists. MOTS-C is a research peptide supplied for laboratory and in vitro use only. All findings described are from preclinical models or early-phase studies. This content does not constitute medical advice.Introduction: Why MOTS-C Research Has a Female Biology ProblemMOTS-C (mitochondrial open reading frame of the…
TB-500 and Tendon Research: Thymosin Beta-4, Tendon Biology and Connective Tissue Repair Mechanisms UK 2026
Research Use Only. TB-500 (Thymosin Beta-4 peptide) is not licensed for tendon or connective tissue treatment in the UK. All content describes preclinical and investigational research biology. Not medical advice.
Thymosin Beta-4 (Tβ4, the active component of TB-500) is an…
ACE-031 and Adipose Biology Research: Myostatin Inhibition, Fat-Muscle Crosstalk and Metabolic Tissue Mechanisms UK 2026Research Use Only. ACE-031 (a fusion protein ActRIIB-Fc) is an investigational compound not licensed for use in the UK outside of clinical trials. All content describes preclinical and investigational research biology. Not medical advice.ACE-031 (a fusion protein comprising the…
Selank and Immune Function Research: Th1/Th2 Immunomodulation, Cytokine Biology and Autoimmune Mechanisms UK 2026Research Use Only. Selank is not licensed as an immunomodulatory agent in the UK outside of approved clinical contexts. All content describes preclinical and investigational research biology. Not medical advice.Selank (Thr-Lys-Pro-Arg-Pro-Gly-Pro, a heptapeptide analogue of the immunomodulatory peptide Tuftsin Thr-Lys-Pro-Arg)…
Epitalon and Skin Ageing Research: Telomere Biology, Fibroblast Senescence and Photoageing Mechanisms UK 2026Research Use Only. Epitalon is not licensed as a dermatological or anti-ageing therapeutic in the UK. All content describes preclinical and investigational research biology. Not medical advice.Skin ageing is driven by two overlapping processes: intrinsic (chronological) ageing, involving telomere shortening,…
MGF and Cardiac Biology Research: Mechano Growth Factor, Cardiomyocyte Survival and Heart Repair Mechanisms UK 2026Research Use Only. MGF (Mechano Growth Factor) and PEG-MGF are not licensed cardiac therapeutics in the UK. All content describes preclinical and investigational research biology. Not medical advice.Mechano Growth Factor (MGF, also known as IGF-1Ec) is a splice…
LL-37 and Skin Research: Dermal Innate Immunity, Wound Repair Biology and Keratinocyte Mechanisms UK 2026Research Use Only. LL-37 is not licensed as a dermatological therapeutic in the UK. All content describes preclinical and investigational research biology. Not medical advice.LL-37 (the C-terminal 37-amino acid peptide of human cathelicidin hCAP-18, sequence [LL-37, 37 aa]) is the only…
GHRP-6 and Bone Research: GH Axis, Osteoblast Biology and Skeletal Mechanisms UK 2026Research Use Only. GHRP-6 is not licensed for osteoporosis or bone disease treatment in the UK. All content describes preclinical and investigational research biology. Not medical advice.Bone biology is intimately regulated by the growth hormone-IGF-1 axis, making GH secretagogues including GHRP-6…
Semax and Autism Research: Neuropeptide Biology, Social Cognition and ASD Mechanisms UK 2026Research Use Only. Semax is not licensed for autism spectrum disorder in the UK. All content describes preclinical and investigational research biology. Not medical advice.Autism spectrum disorder (ASD) is a neurodevelopmental condition characterised by impairments in social communication and interaction alongside…
Best Peptides for Fertility Research UK 2026: HPG Axis Biology, Reproductive Mechanisms and Gonadal ScienceResearch Use Only. All compounds described are investigational peptides not licensed for fertility treatment in the UK. This content is for researchers and laboratory professionals. Not medical advice.Fertility research encompasses the neuroendocrine regulation of reproductive function, gonadal biology, gametogenesis,…
GHK-Cu vs Collagen Peptides: Comparing Skin Regeneration Biology, Collagen Synthesis Mechanisms and Research Applications UK 2026Research Use Only. GHK-Cu is an investigational peptide not licensed as a therapeutic in the UK. Collagen peptides (hydrolysates) are food supplement-grade ingredients. All mechanistic content describes preclinical and investigational research biology. Not medical advice.Both GHK-Cu (copper tripeptide)…
