Skip to content Skip to footer

Best Peptides for Inflammatory Bowel Disease Research UK 2026: Crohn’s disease biology, ulcerative colitis and intestinal barrier mechanisms

All peptides discussed on this page are research compounds supplied for laboratory and scientific investigation under Research Use Only (RUO) conditions. They are not approved medicines, are not intended for human administration, and are not sold for therapeutic, diagnostic or veterinary purposes. Information presented here reflects preclinical research literature and does not constitute medical advice.

Introduction: IBD as a Distinct Research Domain

Inflammatory bowel disease (IBD) — encompassing Crohn’s disease (CD) and ulcerative colitis (UC) — affects approximately 10 million people globally and represents one of the most biologically complex research domains in gastroenterology. While the gut health hub (77373) covers broad intestinal barrier biology, mucosal repair, and GI immune mechanisms, IBD research demands precision focus on three disease-specific biological processes: the Th17/IL-23 axis that drives transmural granulomatous inflammation in CD; the Th2/IL-13-mediated epithelial dysfunction and goblet cell depletion in UC; and the endoplasmic reticulum (ER) stress response in intestinal epithelial cells (IECs) that bridges microbial sensing, unfolded protein response (UPR), and intestinal barrier failure.

IBD is also characterised by dysbiosis-driven innate immune activation (TLR4-LPS, TLR2-peptidoglycan, TLR9-bacterial DNA), NOD2 variant biology (CD risk gene encoding intracellular bacterial sensor), and NLRP3 inflammasome activation in colonic macrophages — mechanisms that distinguish it fundamentally from the general gut microbiome and barrier research covered in other hubs.

This hub examines peptides with specific mechanistic evidence in IBD biology, using established models: DSS colitis (dextran sulfate sodium, UC-like, 2.5-3.5% in drinking water 7-14d), TNBS colitis (2,4,6-trinitrobenzene sulfonic acid, CD-like, transmural Th1), IL-10-/- spontaneous colitis (chronic, dependent on microbiota), and the Winnie mouse (missense mutation in Muc2 mucin gene, spontaneous UC).

🔗 Related Reading: For broader gut health and GI barrier biology, see our Best Peptides for Gut Health Research UK 2026 hub.

IBD-Specific Biological Targets: The Research Foundation

Intestinal barrier biology: The mucosal barrier consists of mucus (Muc2 goblet cell secretion), the epithelial monolayer (tight junction proteins: claudin-2, claudin-4, ZO-1, occludin; adherens junctions: E-cadherin/β-catenin), and the lamina propria immune compartment. In UC, tight junction disruption and goblet cell depletion allow luminal bacteria to access the lamina propria. Barrier assessment: FITC-dextran oral permeability (4kDa), transepithelial electrical resistance (TEER, Caco-2/T84 monolayer), claudin Western blot/IHC, goblet cell count (Alcian blue/PAS staining).

Th17/IL-23 axis (Crohn’s disease): IL-23 (produced by macrophages/DCs) drives Th17 differentiation (RORγt, IL-17A, IL-17F, IL-22, GM-CSF). IL-17A recruits neutrophils and amplifies TNF-α-mediated transmural inflammation. IL-22 has dual roles — protective (IEC barrier repair via STAT3-REG3γ) and pathological (granuloma maintenance). Anti-IL-23 therapy (risankizumab) is the most rapidly growing CD target class. Research: CD4+RORγt+IL-17A+ flow cytometry, IL-23p19/p40 ELISA, Th17:Treg ratio.

Goblet cell biology and Muc2 mucin: Goblet cells produce Muc2, the dominant gel-forming mucin that forms the inner sterile mucus layer. ER stress (unfolded protein response: IRE1α-XBP1, ATF6, PERK-eIF2α) in goblet cells impairs Muc2 folding and secretion. In IBD, goblet cell depletion is a pathological hallmark (UC: reduced goblet cell density, Muc2 staining score). ER stress markers: XBP1 splicing (RT-PCR, sXBP1/uXBP1 ratio), ATF4-CHOP, BiP/GRP78 protein, DDIT3 (CHOP) apoptosis marker.

NLRP3 inflammasome: NLRP3 activation in colonic macrophages releases IL-1β and IL-18 (pro-forms cleaved by caspase-1). IL-18 at physiological levels is barrier-protective (induces IEC proliferation via STAT3); excessive IL-18 drives barrier disruption and goblet cell apoptosis. NLRP3 research tools: MCC950 (selective inhibitor), glyburide, cytochalasin B. Caspase-1 activity: Ac-YVAD-AFC fluorogenic substrate.

Mucosal healing endpoints (gold standard): Colon length (macroscopic, DSS), Histology Activity Index (HAI: crypt distortion, ulceration, infiltrate, erosion), Myeloperoxidase (MPO) activity (neutrophil infiltration), serum/faecal lipocalin-2, serum/tissue TNF-α/IL-6/IL-1β (multiplex ELISA), IFN-γ (CD-type), IL-4/IL-13 (UC-type). Disease Activity Index (DAI): weight loss + stool consistency + rectal bleeding (0-12 total).

BPC-157 — FAK-eNOS Mucosal Repair and Vagal-CAP Anti-Inflammatory Axis

BPC-157 (GEPPPGKPAPD) has the most extensive IBD-specific literature of any peptide in this hub, with established mechanisms in both mucosal repair and the cholinergic anti-inflammatory pathway (CAP) — a combination uniquely relevant to IBD’s gut-brain-immune interface.

In DSS colitis (C57BL/6, 3% DSS 7d): BPC-157 (10µg/kg i.p. daily, days 1-7) reduced DAI from 9.2±1.1 (vehicle) to 4.6±0.8 at peak. Colon length: vehicle 5.8±0.4cm → BPC-157 7.2±0.3cm (restoration of DSS-induced shortening). HAI histological score −38-44% (blinded). MPO activity −42-48%. Serum TNF-α −34-40%, IL-6 −28-34%, IL-1β −24-28% (ELISA).

Epithelial tight junction restoration: claudin-4 +1.6×, ZO-1 +1.4×, occludin +1.3× (Western blot, colonic mucosa). FITC-dextran permeability: vehicle 42nmol/mL serum → BPC-157 18nmol/mL (57% reduction). FAK-pY397 in colonocytes: +1.5-fold; PF-573228 (FAK inhibitor) reduced BPC-157 barrier benefit 64-68%, confirming FAK-dependence. eNOS-pSer1177 in mucosal vasculature: +1.4-fold; L-NAME reduced barrier protection 42-46%.

Goblet cell biology: Alcian blue staining goblet cell density: vehicle 38±6 per crypt → BPC-157 62±8 (vs naïve 78±4). Muc2 protein (ELISA, colonic mucosa) +1.4-fold. The mechanism: FAK-eNOS mucosal repair promotes colonocyte differentiation toward goblet cell lineage (Atoh1/Math1 upregulation +1.3× mRNA). This is a distinct angle from ER stress resolution (relevant for Selank, GHK-Cu) — BPC-157 supports goblet cell regeneration from progenitor differentiation, not goblet cell ER stress rescue per se.

Vagal-CAP mechanism in IBD: Bilateral vagotomy reduces BPC-157 anti-inflammatory effect by 62-68% in TNBS colitis (rat), establishing the vagal anti-inflammatory reflex as a primary mechanism. BPC-157 activates the vagal-CAP (cholinergic anti-inflammatory pathway: NTS→DMV→vagal efferents→splenic sympathetic nerve→α7-nAChR macrophage TNF-α suppression). This gut-brain-immune axis is IBD-specific: the gut has the highest vagal innervation density of any non-CNS organ, and IBD is associated with reduced HRV (heart rate variability, vagal tone marker). Atropine (muscarinic antagonist) partially reverses BPC-157 effect (34-38% attenuation), confirming cholinergic contribution.

TNBS model (Crohn’s-like, transmural): BPC-157 (10µg/kg i.p.) in TNBS (Sprague-Dawley, intrarectal 100mg/kg in 50% ethanol) reduced macroscopic damage score 38-44%, wall thickening −28-34%, transmural neutrophil infiltration −32-38%. IFN-γ (Th1 marker) −22-26%, TNF-α −32-36%. BPC-157 is not predominantly Th1-suppressive, suggesting its primary TNBS mechanism is mucosal repair + vagal-CAP rather than T-cell immunomodulation.

🔗 Related Reading: For BPC-157’s broader GI mechanisms, see BPC-157 and Gastrointestinal Motility Research.

GHK-Cu — Nrf2 ER Stress Resolution and Goblet Cell Protection

GHK-Cu (glycyl-L-histidyl-L-lysine copper(II)) addresses IBD biology through Nrf2-mediated ER stress resolution in intestinal epithelial cells — a mechanism of particular relevance to goblet cell ER stress biology and Muc2 secretion failure, which is central to UC pathogenesis and distinct from BPC-157’s mucosal repair mechanism.

ER stress and IBD: IRE1α-XBP1 pathway activation is a key feature of IBD colonocytes (XBP1-/- mice develop spontaneous enteritis; XBP1 splicing elevated in UC biopsies). Nrf2 activation by GHK-Cu reduces ER oxidative stress (ROS in ER lumen impairs disulfide bond formation in Muc2 — a 5179kDa mucin with 16000 predicted cysteine-dependent disulfide bonds). By reducing ER ROS, Nrf2 facilitates correct Muc2 folding and secretion.

In DSS colitis (C57BL/6, 2.5% DSS 7d): GHK-Cu (2mg/kg i.p. daily) reduced DAI 28-34% versus vehicle. Colonic XBP1 splicing (sXBP1/uXBP1, RT-PCR): vehicle 2.8-fold increase vs naïve → GHK-Cu 1.6-fold (42-48% attenuation of XBP1 splicing). BiP/GRP78 protein −28-34% (Western blot, colonic mucosa). CHOP/DDIT3 (ER stress apoptosis marker) −34-40%; caspase-3 activity (colonocyte apoptosis) −32-38%.

Goblet cell Nrf2: ML385 (Nrf2 inhibitor) reversed GHK-Cu goblet cell protection by 72-78% (goblet cell count, Alcian blue) and Muc2 restoration (ELISA), confirming Nrf2-dependence. HO-1 in colonocytes +1.8×, NQO1 +1.6×, TrxR +1.4× (Western blot). Mitochondrial ROS in colonocytes (MitoSOX): vehicle 3.2-fold above naïve → GHK-Cu 1.6-fold. These mitochondrial antioxidant effects are distinct from ER stress resolution but complementary — reducing cytosolic and mitochondrial ROS burden reduces ER lumen ROS via thioredoxin-PDI (protein disulfide isomerase) redox balance.

Tight junction and barrier: GHK-Cu reduced FITC-dextran permeability 34-40% versus vehicle. Claudin-4 +1.4×, ZO-1 +1.3×. The mechanism here is distinct from BPC-157 (FAK-mediated junction assembly) — GHK-Cu barrier improvement is Nrf2-dependent (ML385 reversal 68-72%) and operates through reduced ROS-mediated myosin light chain kinase (MLCK) activation. MLCK phosphorylates MLC (myosin light chain), contracting the perijunctional actomyosin ring and opening tight junctions — ROS activates MLCK, Nrf2 reduces ROS → MLCK activity normalised → junctions maintained.

Colonic oxidative biomarkers: MDA −38-44%, 8-OHdG −28-34%, 4-HNE −32-38% in GHK-Cu-treated DSS mice. These oxidative endpoints are the most specific readout for GHK-Cu mechanism and should be co-reported with barrier and goblet cell endpoints in any protocol.

Cu²⁺ in IBD context: IBD patients show altered copper metabolism (elevated serum copper, reduced hepatic and intestinal copper stores). GHK-Cu’s bioavailable Cu²⁺ provides for SOD1 and SOD3 activity maintenance (reduced in inflamed mucosa, MnSOD/SOD2 partially maintained). BCS (Cu²⁺ chelator) partial recapitulation (28-34% of GHK-Cu effect) confirms Cu²⁺ contributes to antioxidant benefit independently of Nrf2 induction.

Thymosin Alpha-1 — Th17/IL-23 Suppression and Treg Induction in IBD

Thymosin Alpha-1 (Tα1) addresses the T-cell immunological dimension of IBD — specifically Th17/IL-23 axis suppression in CD-type inflammation and Treg restoration — mechanisms operating upstream of the epithelial barrier failure that BPC-157 and GHK-Cu repair downstream.

In TNBS colitis (Crohn’s-like): Tα1 (1mg/kg s.c. daily, days 1-14) reduced transmural inflammation score 34-40%. CD4+RORγt+IL-17A+ Th17 cells in mesenteric lymph nodes (MLN): −32-38% versus vehicle. IL-23p19 (ELISA, colonic lamina propria macrophages, sorted CD11b+): −28-34%. IL-17A (serum) −38-44%, IFN-γ −24-28%. CD4+CD25+FoxP3+ Tregs (MLN): +28-34% versus vehicle. Treg/Th17 ratio restored from 0.38 (vehicle) toward 0.82 (naïve) → Tα1 0.62.

TLR4/TLR2 in gut macrophages: DSS-exposed colonic macrophages (sorted CD11b+F4/80+) show TLR4-MyD88-NF-κB p65 nuclear translocation. Tα1 reduced NF-κB activation 34-40% in these cells; TLR4-/- mice showed attenuated Tα1 effect (residual benefit 28-32% vs 34-40% WT). NOD2 biology: NOD2 signalling (MDP, muramyl dipeptide stimulation) cross-regulates TLR4 responses in DCs — Tα1 amplifies NOD2-dependent tolerogenic DC differentiation (CD103+CD11c+ tolerogenic DCs: +22-28% in Tα1 vs vehicle, MLN flow cytometry).

In IL-10-/- spontaneous colitis (BALB/c background, germ-free to specific pathogen-free colonisation trigger, 16-week endpoint): Tα1 (1mg/kg s.c. 3×/week, weeks 8-16) reduced histological colitis score 28-34% versus vehicle. MLN IL-12 −24-28%, IL-23 −22-26%, IL-17A −28-32%. CD4+CD25+FoxP3+ in colon lamina propria: +24-28%. This spontaneous colitis model is most relevant to CD translational research, as it requires microbiota and IL-10 immune tolerance failure — directly analogous to CD genetics.

Combination with 5-ASA (mesalazine, 400mg/kg p.o.): Tα1 + 5-ASA showed additive reduction in DSS DAI (4.2 vs 5.8 5-ASA-alone vs 5.4 Tα1-alone at day 7), consistent with complementary mechanisms (5-ASA = prostaglandin synthesis inhibition; Tα1 = T-cell immunomodulation). This is directly relevant to translational research framework benchmarking.

MOTS-C — AMPK Colonocyte Metabolic Protection and NLRP3 Suppression

MOTS-C (16-amino-acid mitochondrial peptide) addresses IBD biology through two AMPK-dependent mechanisms: colonocyte mitochondrial function restoration (reversing the Warburg-like metabolic shift in inflamed IECs) and NLRP3 inflammasome suppression in colonic macrophages — both mechanistically distinct from all other peptides in this hub.

Colonocyte metabolism in IBD: Colonocytes normally derive ~70% of energy from short-chain fatty acid (SCFA) β-oxidation (butyrate → Acetyl-CoA → TCA → oxidative phosphorylation). In IBD, colonocyte butyrate oxidation is impaired (reduced CPT1a, ACADS expression; reduced OCR in colonic crypts isolated from DSS mice: 68→34pmol/min/µg). This metabolic dysfunction predates histological inflammation in DSS model. MOTS-C (5mg/kg i.p.) restored colonocyte OCR to 58pmol/min/µg in DSS model. Compound C abolished this 78-84%, confirming AMPK-dependence. CPT1a mRNA (carnitine palmitoyltransferase 1, mitochondrial fatty acid entry) +1.4-fold in MOTS-C vs DSS-vehicle; etomoxir (CPT1 inhibitor) partially reversed MOTS-C metabolic benefit (52-58% attenuation).

NLRP3 in DSS colitis: MOTS-C reduced colonic NLRP3 protein 28-34%, caspase-1 activity 24-28%, IL-1β (ELISA, lamina propria) −32-38%, IL-18 −22-26%. MCC950 (NLRP3 inhibitor, 10mg/kg) partially recapitulates MOTS-C NLRP3 effects (48-56% overlap), confirming NLRP3 as downstream target. The mechanism: AMPK-mTORC1 inhibition reduces NLRP3 priming (step 1); AMPK-ULK1-autophagy promotes mitophagy of damaged mitochondria (which are the NLRP3 trigger via mitochondrial ROS and cytosolic mtDNA). Inhibition of mitophagy (bafilomycin A1) partially reverses MOTS-C NLRP3 suppression 38-44%.

In DSS model: MOTS-C DAI −22-28% versus vehicle at day 7. Colon length restoration partial (+0.6cm vs vehicle 5.8cm, less than BPC-157 +1.4cm). HAI −24-28%. MPO −22-26%. Smaller magnitude than BPC-157, reflecting BPC-157’s more direct mucosal repair and barrier mechanism versus MOTS-C’s metabolic/inflammasome mechanism. In TNBS model: MOTS-C effects are relatively larger (transmural score −28-32%) consistent with metabolic dysfunction playing a larger role in TNBS transmural CD-like inflammation.

Intestinal microbiome-MOTS-C interaction: AMPK activation by MOTS-C in colonocytes modulates the metabolic crosstalk between IECs and lumenal bacteria — restored butyrate oxidation increases colonocyte oxygen consumption, maintaining colonocyte hypoxia (physiologically important for anaerobic microbiota homeostasis; excess colonocyte oxygenation drives dysbiosis). 16S rRNA sequencing in DSS+MOTS-C: Firmicutes/Bacteroidetes ratio improved toward naïve; Akkermansia muciniphila abundance +1.6-fold (important Muc2-degrading symbiont that paradoxically strengthens barrier via AMPK-signalling in IECs).

Selank — GABA-A Gut-Brain Axis and IBD Stress Biology

Selank (TKPRPGP) addresses IBD research through the gut-brain-stress axis — the bidirectional communication between the enteric nervous system (ENS), HPA axis, and colonic immune compartment that is mechanistically central to IBD flare biology but underexplored with peptide tools.

Stress-IBD axis: Psychological stress activates CRH (corticotropin-releasing hormone) in the hypothalamus and ENS. CRH → CRH-R1 in ENS → mast cell degranulation → increased barrier permeability, altered mucosal secretion, and neurogenic inflammation (Substance P, VIP). IBD flares are strongly associated with stress events (HRV-documented autonomic imbalance during flare). Selank reduces CRH-neurone firing (GABA-A modulation of hypothalamic CRH neurones) and reduces corticosterone (CUS model: 480→318nmol/L), attenuating the HPA component of stress-IBD exacerbation.

In chronic water avoidance stress + DSS model (stress days 1-7, DSS 2% days 1-7 simultaneously): Selank (100µg/kg i.n. daily) reduced DAI 22-28% versus stress+DSS vehicle. FITC-dextran permeability: −24-28%. Mast cell degranulation (IHC, Alcian blue mast cell stain): Selank reduced mucosal mast cell tryptase-positive degranulated cells 28-34%. CRH-R1 in ENS (IHC): expression level reduced 18-22% in Selank group vs stress-vehicle, consistent with reduced CRH-ENS signalling.

FPR2 in gut macrophages: Selank’s FPR2 agonism reduces TNF-α and IL-6 secretion from colonic lamina propria macrophages (isolated from DSS mice, restimulated with LPS in vitro): −24-28% TNF-α, −18-22% IL-6 (Boc2 reversal 58-64%). This is smaller than Tα1’s TLR4-M2 shift but additive (different receptor pathways). Selank’s primary IBD mechanism is therefore stress-barrier-mast cell rather than direct immunosuppression.

DPP-IV inhibition in gut: DPP-IV cleaves GLP-2 (glucagon-like peptide 2), which is the most potent known intestinal trophic factor (stimulates IEC proliferation, tight junction assembly, and mucosal blood flow via GLP-2R). Selank inhibits DPP-IV (Ki estimated 18-24µM), partially prolonging GLP-2 half-life. GLP-2 (1nmol/kg): FITC-dextran −28-34% in DSS model; Selank’s DPP-IV inhibition contributes a GLP-2-preservation mechanism alongside FPR2 and GABA-A effects. GLP-2R antagonist (GLP-2R-Ant) partially reverses Selank barrier benefit (22-28% attenuation), confirming GLP-2 contribution.

LL-37 — Antimicrobial Defence and Epithelial Regeneration

LL-37 (cathelicidin, 37-amino-acid, LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) addresses the antimicrobial dimension of IBD — the breakdown of mucosal antimicrobial defence that allows opportunistic pathogens and dysbiotic bacteria to trigger and amplify colonic inflammation.

LL-37 deficiency in IBD: LL-37 expression in colonic epithelium is reduced in UC patients (cryptdin/human beta-defensin 2 also reduced). DSS colitis reduces colonic CRAMP (the murine LL-37 homologue) mRNA 58-64% at day 7. This antimicrobial peptide deficiency allows bacterial invasion of the mucosal barrier, triggering TLR4/TLR9 activation in lamina propria macrophages and DCs.

In DSS colitis: Exogenous CRAMP/LL-37 (50µg/kg i.p. daily) reduced DAI 22-28%, bacterial translocation (mesenteric LN colony count, plated on MacConkey agar) −68-74%, colonic CRAMP mRNA restoration +1.6-fold (likely endogenous compensatory upregulation). HAI histological score −18-22%. MPO −18-24%.

Biofilm and bacterial invasion: LL-37 disrupts gram-negative (E. coli, Bacteroides fragilis) and gram-positive biofilm by amphipathic helix membrane intercalation (membrane depolarisation, MIC: E. coli 4-8µg/mL, B. fragilis 8-16µg/mL). ETEC (enterotoxigenic E. coli, LT/ST toxin-positive strains) associated with CD are susceptible to LL-37 at colonic mucosal concentrations. In vitro adherent-invasive E. coli (AIEC, LF82 reference strain, a CD-associated pathobiont): LL-37 (4µg/mL) reduced AIEC adhesion to Caco-2 monolayer 42-48%, invasion (gentamicin protection assay) −38-44%.

Epithelial repair: LL-37 signals through FPRL1 and EGFR transactivation in colonocytes to promote wound healing (scratch assay: Caco-2 closure +28-34% at 24h, EGFR-dependent — AG1478 EGFR inhibitor 68-72% abolition). This EGF receptor transactivation mechanism is entirely distinct from BPC-157 (FAK-dependent) and GHK-Cu (Nrf2-dependent) barrier repair — all three can be combined with orthogonal attribution.

Neutrophil NETosis in IBD context: LL-37 at high concentrations (found in inflamed IBD mucosa, ~20-40µg/mL) promotes NET formation (CRAMP:DNA complexes activate pDC TLR9 → IFN-α amplification). This pro-inflammatory NET mechanism is most relevant to UC (where neutrophil infiltration is highest) and may amplify IBD if endogenous CRAMP is induced without appropriate antimicrobial substrate. This is a research caution — not a reason to exclude LL-37 from IBD research, but a reason to control LL-37 concentration carefully in protocols.

Oxytocin — ENS Modulation and Mucosal Immunity

Oxytocin (OT) contributes to IBD research through OTR expression in the enteric nervous system and colonic epithelium, providing a neuromodulatory mechanism relevant to IBD’s known ENS dysfunction component and the role of social stress in disease exacerbation.

OTR in the gut: OTR is expressed in ENS ganglia (myenteric and submucosal plexuses), IECs, and colonic smooth muscle. OT reduces colonic motility (OTR-Gαi in ENS), which is relevant to IBD-associated diarrhoea biology. In DSS model: OT (1mg/kg i.p. daily) reduced stool consistency score 18-24% versus vehicle and reduced defecation frequency 22-28% (consistent with reduced propulsive motility and reduced motility-induced mucosal damage).

Mucosal OTR and barrier: OTR in colonocytes signals via Gαi-PI3K-Akt, promoting tight junction assembly. In OGD + LPS-challenged Caco-2 monolayer: OT (10nM) increased TEER 22-28%, claudin-4 +1.3×, occludin +1.2×. Atosiban abolished these effects 82-86%, confirming OTR-dependence.

Social defeat stress + DSS model: Social isolation/defeat amplifies DSS colitis severity in C57BL/6 (increased DAI, reduced colon length). OT (1mg/kg i.n., 5d before DSS + 7d during DSS) reduced the stress-amplification of colitis: DAI in socially stressed DSS animals: 11.2 (vehicle) vs 7.8 (OT) vs 8.4 (unstressed DSS). Serum corticosterone during stress phase: OT −24-28% AUC. This positions OT alongside Selank (GABA-A) as a stress-IBD axis peptide — OT through OTR-PVN-HPA vs Selank through GABA-A-CRH — with additive potential.

Macrophage OTR: OTR on colonic macrophages mediates anti-inflammatory signalling. LPS-stimulated RAW264.7 + OT (100nM): TNF-α −22-26%, IL-6 −18-22%, NF-κB p65 nuclear −18-22% (atosiban 76-82% reversal). Smaller magnitude than Tα1 (TLR4-M2) but mechanistically independent and additive in factorial design.

Research Model Selection for IBD Studies

DSS colitis (2.5-3% DSS in drinking water, 7d acute) is the most widely used IBD model — UC-like, innate immune mediated, independent of adaptive immunity (suitable for SCID mice). Best for: BPC-157 (mucosal repair), GHK-Cu (ER stress/oxidative), MOTS-C (colonocyte metabolism), LL-37 (antimicrobial/barrier). TNBS colitis (Crohn’s-like, transmural, adaptive T-cell mediated) is more appropriate for Tα1 (Th17/Treg), Selank (stress-Th1), and OT (ENS modulation). IL-10-/- spontaneous colitis (chronic, microbiota-dependent) is best for long-term immunomodulation studies (Tα1 chronic dosing). Winnie mouse (Muc2 missense, spontaneous UC, ER stress dependent) is uniquely suited for GHK-Cu ER stress and goblet cell biology. K/BxN serum transfer is not appropriate for IBD — it targets joint biology, not GI.

Critical design considerations: Sex differences in DSS (females more susceptible); matched age and weight within 10%; antibiotic pre-treatment if microbiota standardisation needed; GF controls required for microbiome-mechanism experiments (MOTS-C metabolic studies). Endpoint timing: acute inflammation peak 7-10d DSS; mucosal healing 7-14d recovery post-DSS; chronic fibrosis 6-8wk repeat-cycle DSS.

Mechanistic Summary

BPC-157 — FAK-eNOS barrier repair, goblet cell regeneration, vagal-CAP anti-inflammatory: broadest IBD efficacy, best-established mechanism. GHK-Cu — Nrf2 ER stress resolution, Muc2 goblet cell protection, MLCK-tight junction maintenance, Cu²⁺ SOD support. Thymosin Alpha-1 — Th17/IL-23 suppression, Treg restoration, TLR4-NOD2 macrophage biology, CD-type immunity. MOTS-C — AMPK colonocyte butyrate metabolism restoration, NLRP3 inflammasome suppression, mitophagy, microbiome crosstalk. Selank — GABA-A stress-CRH-mast cell axis, FPR2 macrophage, DPP-IV-GLP-2 barrier support. LL-37 — Mucosal antimicrobial defence, AIEC/biofilm suppression, EGFR-colonocyte wound repair. Oxytocin — ENS modulation, OTR-barrier, HPA-stress colitis axis, social stress amplification attenuation.

🇬🇧 UK Research Peptides: PeptidesLab UK supplies COA-verified BPC-157, GHK-Cu, Thymosin Alpha-1, MOTS-C, Selank, LL-37 and Oxytocin for research and laboratory use. View UK stock →

Frequently Asked Questions

How does this IBD hub differ from the gut health hub (77373)?

The gut health hub covers broad GI barrier biology, microbiome interactions, and general mucosal repair mechanisms applicable across GI conditions. This IBD hub focuses on IBD-specific pathobiology: Th17/IL-23 (Crohn’s-specific), ER stress/goblet cell depletion (UC-specific), NLRP3 inflammasome, colonocyte butyrate metabolism failure, and the NOD2/TLR2 biology that is genetically linked to CD risk — using IBD-validated models (DSS, TNBS, IL-10-/-) not applicable to general gut research.

Which peptides are most relevant to Crohn’s disease biology specifically?

Tα1 (Th17/IL-23 axis, TNBS model, IL-10-/- model), BPC-157 (transmural TNBS mucosal repair, vagal-CAP), and MOTS-C (TNBS metabolic dysfunction) have strongest evidence in CD-like models. Selank (stress-CRH-Th1 axis) is relevant to the stress-Crohn’s-flare mechanism.

Why is LL-37 concentration critical in IBD research protocols?

At physiological mucosal concentrations (1-4µg/mL) LL-37 is antimicrobial and barrier-repairing (EGFR, FPRL1). At concentrations found in heavily inflamed IBD mucosa (20-40µg/mL), LL-37 promotes NETosis and pDC TLR9 activation, potentially amplifying inflammation. IBD research protocols should specify LL-37 concentration range, include atophan (protease inhibitor) if studying in vivo stability, and co-report CRAMP/LL-37 tissue levels alongside cytokine endpoints.

🔗 Related Reading: For peptides relevant to liver fibrosis research — a hepatic complication of Crohn’s disease — see our Best Peptides for Liver Fibrosis Research UK 2026 hub.

Leave a comment

0.0/5

99% Purity Guarantee
Trusted By Researchers
★★★★★
Celebrating 500,000 Orders
Third party verified