This article is prepared for researchers and laboratory scientists investigating growth factor biology in immune contexts. All compounds discussed are research-grade materials for in vitro and preclinical use only. This content does not constitute medical advice or clinical guidance.Introduction: MGF at the Exercise-Immune Interface
Mechano Growth Factor (MGF) is an alternatively spliced isoform of…
William
This article is prepared for researchers and laboratory scientists investigating immune biology and neuropeptide pharmacology. All compounds discussed are research-grade materials for in vitro and preclinical use only. This content does not constitute medical advice or clinical guidance.Introduction: Kisspeptin-10 Beyond the HPG Axis
Kisspeptin-10 (KP-10; Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂) is the C-terminal decapeptide fragment of the kisspeptin-54…
This article is prepared for researchers and laboratory scientists investigating neuropeptide biology in reproductive contexts. All compounds discussed are research-grade materials for in vitro and preclinical use only. This content does not constitute medical advice or clinical guidance.Introduction: Selank at the Stress-Reproductive Interface
Selank (Thr-Lys-Pro-Arg-Pro-Gly-Pro) is a synthetic heptapeptide analogue of the endogenous immunomodulatory…
This article is written for researchers and laboratory scientists exploring neuropeptide biology in reproductive contexts. All compounds discussed are research-grade materials intended for in vitro and preclinical laboratory use only. This content does not constitute medical advice or clinical guidance.Introduction: Semax as a Neuroendocrine Tool in Reproductive Research
Semax (Met-Glu-His-Phe-Pro-Gly-Pro) is a synthetic heptapeptide…
This article is intended for researchers and laboratory scientists investigating mitochondrial-derived peptide biology in reproductive contexts. All compounds discussed are research-grade materials supplied for in vitro and preclinical use only. Nothing in this article constitutes medical advice or clinical guidance.Introduction: MOTS-C as a Mitochondria-to-Nucleus Signal in Reproductive Tissues
MOTS-C (mitochondrial open reading frame of…
Epitalon (Ala-Glu-Asp-Gly; tetrapeptide; MW 390.3 Da) is a synthetic pineal peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Epitalon and the Ageing Reproductive System: Telomere…
GHK-Cu (glycyl-L-histidyl-L-lysine copper(II) complex) is a synthetic copper-binding tripeptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.GHK-Cu in Reproductive Biology: Copper Peptide Beyond Skin and…
Ipamorelin is a synthetic pentapeptide GH secretagogue supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Ipamorelin: A Selective GHS-R1a Agonist With Distinct Immune BiologyIpamorelin (Aib-His-D-2-Nal-D-Phe-Lys-NH₂;…
Sermorelin (GHRH 1–29 NH₂) is a synthetic 29-amino acid growth hormone-releasing hormone analogue supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Sermorelin and the Brain: GHRH…
LL-37 is a synthetic cathelicidin antimicrobial peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.LL-37 in the Central Nervous System: Beyond Antimicrobial BiologyLL-37 ([LL-37, 37 aa];…
BPC-157 (Body Protection Compound 157) is a synthetic 15-amino acid peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.BPC-157: Immunomodulatory Biology of a Gastric Cytoprotective…
GHRP-6 and Hexarelin are synthetic GH secretagogue peptides supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Introduction: Two GHS-R1a Agonists, Distinct Immune ProfilesGHRP-6 (His-D-Trp-Ala-Trp-D-Phe-Lys-NH₂; MW…
