Skip to content Skip to sidebar Skip to footer

Blog

MOTS-C and Reproductive Biology Research

This article is intended for researchers and laboratory scientists investigating mitochondrial-derived peptide biology in reproductive contexts. All compounds discussed are research-grade materials supplied for in vitro and preclinical use only. Nothing in this article constitutes medical advice or clinical guidance.Introduction: MOTS-C as a Mitochondria-to-Nucleus Signal in Reproductive Tissues MOTS-C (mitochondrial open reading frame of…

Read More

Epitalon and Reproductive Biology Research

Epitalon (Ala-Glu-Asp-Gly; tetrapeptide; MW 390.3 Da) is a synthetic pineal peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Epitalon and the Ageing Reproductive System: Telomere…

Read More

GHK-Cu and Reproductive Biology Research

GHK-Cu (glycyl-L-histidyl-L-lysine copper(II) complex) is a synthetic copper-binding tripeptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.GHK-Cu in Reproductive Biology: Copper Peptide Beyond Skin and…

Read More

Ipamorelin and Immune Function Research

Ipamorelin is a synthetic pentapeptide GH secretagogue supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Ipamorelin: A Selective GHS-R1a Agonist With Distinct Immune BiologyIpamorelin (Aib-His-D-2-Nal-D-Phe-Lys-NH₂;…

Read More

Sermorelin and Neurological Research

Sermorelin (GHRH 1–29 NH₂) is a synthetic 29-amino acid growth hormone-releasing hormone analogue supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Sermorelin and the Brain: GHRH…

Read More

LL-37 and Neurological Research

LL-37 is a synthetic cathelicidin antimicrobial peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.LL-37 in the Central Nervous System: Beyond Antimicrobial BiologyLL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;…

Read More

BPC-157 and Immune Function Research

BPC-157 (Body Protection Compound 157) is a synthetic 15-amino acid peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.BPC-157: Immunomodulatory Biology of a Gastric Cytoprotective…

Read More

GHRP-6 vs Hexarelin for Immune Research

GHRP-6 and Hexarelin are synthetic GH secretagogue peptides supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Introduction: Two GHS-R1a Agonists, Distinct Immune ProfilesGHRP-6 (His-D-Trp-Ala-Trp-D-Phe-Lys-NH₂; MW…

Read More

Retatrutide and Immune Biology Research

Retatrutide (LY3437943) is a synthetic triple receptor agonist targeting GIP, GLP-1 and glucagon receptors, supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Retatrutide: Triple Incretin Biology…

Read More

Melanotan 2 and Neurological Research

Melanotan 2 (MT-II) is a synthetic melanocortin receptor agonist supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Melanotan 2: Melanocortin Receptors in the Central Nervous System…

Read More

Follistatin and Immune Function Research

Follistatin (FST) is a synthetic peptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Follistatin: Activin Antagonism at the Immune InterfaceFollistatin (FST; MW ~35 kDa…

Read More

Oxytocin and Male Reproductive Biology Research

Oxytocin is a synthetic neuropeptide supplied exclusively for in vitro and in vivo preclinical research. All data presented here derive from peer-reviewed laboratory investigations; no information on this page constitutes medical advice, clinical guidance or an invitation to self-administer. Research use only.Oxytocin in Male Reproductive Biology: Beyond Uterine ContractionOxytocin (OT; MW 1,007 Da;…

Read More

99% Purity Guarantee
Trusted By Researchers
★★★★★
Celebrating 500,000 Orders
Third party verified